SLC25A4 Rabbit Polyclonal Antibody

CAT#: TA334077

Rabbit Polyclonal Anti-SLC25A4 Antibody

Product Images

WB Suggested Anti-SLC25A4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: RPMI 8226 cell lysate;SLC25A4 is supported by BioGPS gene expression data to be expressed in RPMI 8226

• 

  Rabbit Anti-SLC25A4 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Seco

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: solute carrier family 25 member 4
• Database Link:
  NP_001142
  Entrez Gene 85333 RatEntrez Gene 291 Human
  UniProt ID P12235
• Background: This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
• Synonyms: 1; AAC1; ANT; ANT 1; ANT1; MTDPS12; PEO2; PEO3; T1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease