Antibodies

Jump to Filters
View as table Download
DDB2 Rabbit Polyclonal Antibody
TA327198

USD 275.00

3 Weeks

DDB2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDB2
DDB2 Rabbit Polyclonal Antibody
TA342865

USD 375.00

5 Days

Rabbit Polyclonal Anti-DDB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDB2 antibody: synthetic peptide directed towards the C terminal of human DDB2. Synthetic peptide located within the following region: IVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEF
DDB2 Mouse Monoclonal Antibody [Clone ID: OTI2E12]
CF810712

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated
DDB2 Mouse Monoclonal Antibody [Clone ID: OTI2E12]
TA810712

USD 379.00

In Stock

DDB2 mouse monoclonal antibody,clone OTI2E12

Applications WB
Reactivities Human
Conjugation Unconjugated
DDB2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E12]
TA810712BM

USD 420.00

4 Weeks

DDB2 mouse monoclonal antibody,clone OTI2E12, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP