Antibodies

Jump to Filters
View as table Download
DPP6 Rabbit Polyclonal Antibody
TA316675

USD 425.00

5 Days

DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Chimpanzee, Xenopus, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat
Immunogen DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from extracellular domain of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Horse, Rabbit, Xenopus (100%); Pig, Opossum, Platypus, Lizard (94%); Turkey, Chicken, Zebrafish (89%); Stickleback, Pufferfish (83%).
DPP6 Rabbit Polyclonal Antibody
TA336001

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ
DPP6 Rabbit Polyclonal Antibody
TA316674

USD 425.00

5 Days

DPP6 / Dipeptidylpeptidase 6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Chimpanzee, Gorilla, Human
Immunogen DPP6 / Dipeptidylpeptidase 6 antibody was raised against synthetic 18 amino acid peptide from near the center of human DPP6. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Gibbon, Monkey (94%); Horse (89%); Panda, Bovine (83%).
DPP6 Rabbit Polyclonal Antibody
TA336000

USD 375.00

5 Days

Rabbit Polyclonal Anti-DPP6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSISLHVIGLNGPT