DPP6 Rabbit Polyclonal Antibody

CAT#: TA336001

Rabbit Polyclonal Anti-DPP6 Antibody

Product Images

WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

• 

  Lanes: Lane 1: 20ug mouse WT brain extract; Lnae 2: DPP6 -/- mouse brain extract; Lane 3: 20ug mouse WT brain extract; 4: DPP6 -/- mouse brain extract; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Donkey anti-rabbit-HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: DPP6 a; Submitted by: Jeanne M. Nerbonne, Arvin Soepriatna, Washington University Medical School Department of Developmental Biology;

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DPP6 Antibody: synthetic peptide directed towards the middle region of human DPP6. Synthetic peptide located within the following region: FLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: dipeptidyl peptidase like 6
• Database Link:
  NP_001034439
  Entrez Gene 13483 MouseEntrez Gene 1804 Human
  UniProt ID P42658
• Background: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: DPL1; DPPX; MRD33; VF2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane