Antibodies

Jump to Filters
View as table Download
Glypican 3 (GPC3) Rabbit Polyclonal Antibody
TA332471

USD 275.00

3 Weeks

Rabbit anti-GPC3 Polyclonal Antibody

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GPC3
Glypican 3 (GPC3) Rabbit Polyclonal Antibody
TA331451

USD 310.00

5 Days

Rabbit polyclonal Anti-GPC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
Glypican 3 (GPC3) (C-term) Rabbit Polyclonal Antibody
AP51902PU-N

USD 450.00

2 Weeks

Glypican 3 (GPC3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 464-494 amino acids from the C-terminal region of human GPC3
Glypican 3 (GPC3) Mouse Monoclonal Antibody [Clone ID: 1G12]
TA327687

USD 985.00

5 Days

Mouse Monoclonal Glypican 3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated