Glypican 3 (GPC3) Rabbit Polyclonal Antibody

CAT#: TA331451

Rabbit polyclonal Anti-GPC3 Antibody

Product Images

WB Suggested Anti-GPC3 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

• 

  Rabbit Anti-GPC3 antibody; Catalog Number: ARP37665_T100; Paraffin Embedded Tissue: Human Placenta cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPC3 antibody: synthetic peptide directed towards the middle region of human GPC3. Synthetic peptide located within the following region: FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: glypican 3
• Database Link:
  NP_004475
  Entrez Gene 2719 Human
  UniProt ID P51654
• Background: Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
• Synonyms: DGSX; GTR2-2; MXR7; OCI-5; SDYS; SGB; SGBS; SGBS1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome