Antibodies

View as table Download

Rabbit anti-IL27 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL27

Rabbit Polyclonal IL-27 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-27 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-27.

IL27 mouse monoclonal antibody, clone B-G49, Azide Free

Applications FC
Reactivities Human

IL27 mouse monoclonal antibody, clone B-G49, FITC

Applications FC
Reactivities Human
Conjugation FITC

IL27 mouse monoclonal antibody, clone B-G49, Purified

Applications FC
Reactivities Human

IL27 mouse monoclonal antibody, clone B-G44, Azide Free

Applications ELISA
Reactivities Human

Rabbit Polyclonal IL-27 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IL-27 antibody was raised against a 14 amino acid peptide from near the center of human IL-27.

Rabbit Polyclonal Anti-IL27 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL27 antibody: synthetic peptide directed towards the C terminal of human IL27. Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ

Anti-IL27 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-IL27 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein