Antibodies

View as table Download

Rabbit Polyclonal Kif2a Antibody

Reactivities Human, Mammalian, Mouse, Rat
Conjugation Unconjugated
Immunogen Produced by immunizing rabbits with a recombinant segment of the N-terminal domain of the human protein.

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the middle region of human KIF2A. Synthetic peptide located within the following region: DSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the N terminal of human KIF2A. Synthetic peptide located within the following region: IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPS

Rabbit Polyclonal Anti-KIF2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIF2A antibody: synthetic peptide directed towards the C terminal of human KIF2A. Synthetic peptide located within the following region: ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED

Rabbit Polyclonal Anti-KIF2A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KIF2A