Rabbit Polyclonal Anti-MSH5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MSH5 |
Rabbit Polyclonal Anti-MSH5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MSH5 |
Rabbit Polyclonal Anti-MSH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH5 antibody: synthetic peptide directed towards the N terminal of human MSH5. Synthetic peptide located within the following region: DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP |
Rabbit Polyclonal Anti-MSH5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH5 antibody: synthetic peptide directed towards the N terminal of human MSH5. Synthetic peptide located within the following region: KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI |
MSH5 goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_079535.3, NP_751897.1, NP_002432.1. |