Antibodies

View as table Download

Rabbit Polyclonal Anti-RABEPK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Rabbit Polyclonal Anti-RABEPK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RABEPK antibody: synthetic peptide directed towards the N terminal of human RABEPK. Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL