Antibodies

View as table Download

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG

AMH (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 424-451 amino acids from the Central region of human AMH

Rabbit anti-AMH polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Anti-AMH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone

Anti-AMH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 539-551 amino acids of human anti-Mullerian hormone

AMH Rabbit monoclonal antibody, clone OTIR1B8

AMH Rabbit monoclonal antibody, clone OTIR1F8

AMH Rabbit monoclonal antibody, clone OTIR5C9

AMH Rabbit monoclonal antibody, clone OTIR1E3

AMH Rabbit monoclonal antibody, clone OTIR2G3

AMH Rabbit monoclonal antibody, clone OTIR2B5

AMH Rabbit monoclonal antibody, clone OTIR3B3

AMH Rabbit monoclonal antibody, clone OTIR3G5

AMH Rabbit monoclonal antibody, clone OTIR4F7

AMH Rabbit monoclonal antibody, clone OTIR4G8

AMH Rabbit monoclonal antibody, clone OTIR1A3

AMH Rabbit monoclonal antibody, clone OTIR5C11

AMH Rabbit monoclonal antibody, clone OTIR5D9

AMH Rabbit monoclonal antibody, clone OTIR2G3B5

AMH Rabbit monoclonal antibody, clone OTIR2H6

AMH Rabbit monoclonal antibody, clone OTIR5B9

AMH Capture Rabbit Monoclonal antibody, clone OTIR5D9

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated

AMH HRP-Conjugated detection Rabbit Monoclonal antibody, clone OTIR5C11

Applications ELISA, LMNX
Reactivities Human
Conjugation Unconjugated
Matched ELISA Pair TA600549