CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-CAPNS1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPNS1 antibody: synthetic peptide directed towards the middle region of human CAPNS1. Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL |
Anti-CAPNS1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1 |
Anti-CAPNS1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1 |