Antibodies

View as table Download

CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

CAPNS1 mouse monoclonal antibody, clone AT1D11, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Rabbit Polyclonal Anti-CAPNS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAPNS1 antibody: synthetic peptide directed towards the middle region of human CAPNS1. Synthetic peptide located within the following region: RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Anti-CAPNS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1

Anti-CAPNS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 91-268 amino acids of human calpain, small subunit 1