Rabbit Polyclonal DC-SIGN Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-DIGN . |
Rabbit Polyclonal DC-SIGN Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-DIGN . |
Rabbit Polyclonal DC-SIGN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-SIGN . |
Mouse DC-SIGN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse DC-SIGN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rat Anti-Human CD209 (DC-SIGN) Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CD209 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.389~393( E-Q-F-L-S )derived from Human CD209 (DC-SIGN). |
Rabbit polyclonal antibody to DC-SIGN(CD209) (CD209 molecule)
Reactivities | Human |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 404 of DC-SIGN (Uniprot ID#Q9NNX6) |
Rabbit Polyclonal anti-CD209 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD209 antibody: synthetic peptide directed towards the N terminal of human CD209. Synthetic peptide located within the following region: AGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQL |
Rabbit Polyclonal anti-CD209 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CD209 antibody is: synthetic peptide directed towards the C-terminal region of Human CD209. Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |