Rabbit polyclonal antibody to Cdk3 (cyclin-dependent kinase 3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 238 of Cdk3 (Uniprot ID#Q00526) |
Rabbit polyclonal antibody to Cdk3 (cyclin-dependent kinase 3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 238 of Cdk3 (Uniprot ID#Q00526) |
Rabbit Polyclonal Anti-CDK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK3 antibody: synthetic peptide directed towards the C terminal of human CDK3. Synthetic peptide located within the following region: NLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRF |
Rabbit anti Cdk3 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CDK3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 235-250 amino acids of Human cyclin-dependent kinase 3 |