Antibodies

View as table Download

Rabbit Polyclonal Anti-FBXO31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXO31 Antibody: synthetic peptide directed towards the middle region of human FBXO31. Synthetic peptide located within the following region: QGPRESQPSPAQPRAEAPSKGPDGTPGEDGGEPGDAVAAAEQPAQCGQGQ

Rabbit Polyclonal Anti-FBXO31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FBXO31 Antibody: synthetic peptide directed towards the middle region of human FBXO31. Synthetic peptide located within the following region: VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS

Carrier-free (BSA/glycerol-free) FBXO31 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) FBXO31 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-FBXO31 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FBXO31

FBXO31 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FBXO31 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FBXO31 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

FBXO31 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated