G3BP (G3BP1) mouse monoclonal antibody, clone 2F3
Applications | ELISA, IF, IHC, RNAi, WB |
Reactivities | Human |
G3BP (G3BP1) mouse monoclonal antibody, clone 2F3
Applications | ELISA, IF, IHC, RNAi, WB |
Reactivities | Human |
Rabbit Polyclonal G3BP-1 (Ser232) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human G3BP-1 around the phosphorylation site of Serine 232 |
Modifications | Phospho-specific |
Rabbit polyclonal Anti-G3BP1 Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP |
Rabbit anti-G3BP1 (Phospho-Ser232) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanG3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A). |
Modifications | Phospho-specific |
Rabbit anti-G3BP1 polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanG3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A). |
Rabbit polyclonal G3BP-1 (Ser232) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human G3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A). |
Modifications | Phospho-specific |
Rabbit Polyclonal G3BP-1 Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human G3BP-1 |
Rabbit polyclonal Anti-G3BP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G3BP antibody: synthetic peptide directed towards the N terminal of human G3BP. Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE |