Antibodies

View as table Download

G3BP (G3BP1) mouse monoclonal antibody, clone 2F3

Applications ELISA, IF, IHC, RNAi, WB
Reactivities Human

Rabbit Polyclonal G3BP-1 (Ser232) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human G3BP-1 around the phosphorylation site of Serine 232
Modifications Phospho-specific

Rabbit polyclonal Anti-G3BP1 Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP

Rabbit anti-G3BP1 (Phospho-Ser232) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanG3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A).
Modifications Phospho-specific

Rabbit anti-G3BP1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanG3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A).

Rabbit polyclonal G3BP-1 (Ser232) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human G3BP-1 around the phosphorylation site of serine 232 (S-S-SP-P-A).
Modifications Phospho-specific

Rabbit Polyclonal G3BP-1 Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human G3BP-1

Rabbit polyclonal Anti-G3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G3BP antibody: synthetic peptide directed towards the N terminal of human G3BP. Synthetic peptide located within the following region: EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE