Antibodies

Jump to Filters
View as table Download
GTP cyclohydrolase 1 (GCH1) Goat Polyclonal Antibody
TA305613

USD 375.00

2 Weeks

Goat Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GKVHIGYLPNKQ, from the internal region of the protein sequence according to NP_000152.1 ; NP_001019195.1 ; NP_001019241.1 ; NP_001019242.1 .
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA321072

USD 345.00

In Stock

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342673

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA342674

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCH1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR
GTP cyclohydrolase 1 (GCH1) Rabbit Polyclonal Antibody
TA323417

USD 345.00

4 Weeks

Anti-GCH1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-64 amino acids of human GTP cyclohydrolase 1
GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI1A3]
TA810243S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI3C9]
TA810244S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI3C9

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI3A3]
TA810245S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI3A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI2E2]
TA810246S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI2E2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI1E3]
TA810247S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI1E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
TA810248S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI2D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI8C6]
TA810249S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI8C6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI7B8]
TA810250S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI7B8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody [Clone ID: OTI5A1]
TA810265S

USD 159.00

2 Days

GCH1 mouse monoclonal antibody,clone OTI5A1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".