Antibodies

View as table Download

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.

Rabbit polyclonal anti-MASTL antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human MASTL.

Rabbit Polyclonal Anti-MASTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASTL antibody: synthetic peptide directed towards the C terminal of human MASTL. Synthetic peptide located within the following region: NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL