Rabbit polyclonal anti-MTLR antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MTLR. |
Rabbit polyclonal anti-MTLR antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MTLR. |
Motilin receptor (MLNR) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 364-394 amino acids from the C-terminal region of Human Motilin receptor. |
Rabbit Polyclonal Anti-MLNR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MLNR antibody is: synthetic peptide directed towards the C-terminal region of Human MLNR. Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD |
Rabbit Polyclonal Anti-MLNR Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | MLNR/GPR38/Motilin Receptor antibody was raised against synthetic 16 amino acid peptide from C-terminal cytoplasmic domain of human MLNR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Marmoset (81%). |
Rabbit Polyclonal Anti-MLNR Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MLNR |