Antibodies

Jump to Filters
View as table Download
PCBD1 (Center) Rabbit Polyclonal Antibody
AP53190PU-N

USD 450.00

2 Weeks

PCBD1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 27~56 amino acids from the Center region of human PCBD1
PCBD1 Rabbit Polyclonal Antibody
TA330545

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCBD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBD1 antibody: synthetic peptide directed towards the N terminal of human PCBD1. Synthetic peptide located within the following region: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFM
PCBD1 Rabbit Polyclonal Antibody
TA335170

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCBD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBD1 antibody: synthetic peptide directed towards the N terminal of human PCBD1. Synthetic peptide located within the following region: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMT