Antibodies

View as table Download

Rabbit Polyclonal Anti-PLXNA4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLXNA4 antibody: synthetic peptide directed towards the middle region of human PLXNA4. Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV

Rabbit Polyclonal Anti-PLXNA4 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PLXNA4