Antibodies

View as table Download

Mouse Monoclonal anti-RHO Antibody

Applications IF
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-RHO (rhodopsin) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RHO.

Mouse Monoclonal anti-RHO Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Anti-Rhodopsin Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-RHO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHO antibody: synthetic peptide directed towards the C terminal of human RHO. Synthetic peptide located within the following region: AFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTE