Antibodies

Jump to Filters
View as table Download
ANGPTL5 Rabbit Polyclonal Antibody
TA333434

USD 375.00

5 Days

Rabbit Polyclonal Anti-ANGPTL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ANGPTL5 Antibody: synthetic peptide directed towards the N terminal of human ANGPTL5. Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
ANGPTL5 Rabbit Polyclonal Antibody
TA350735

USD 345.00

In Stock

Rabbit Polyclonal Anti-ANGPTL5 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANGPTL5
ANGPTL5 Rabbit Polyclonal Antibody
TA357262

USD 360.00

5 Days

ANGPTL5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated