ANGPTL5 Rabbit Polyclonal Antibody

CAT#: TA333434

Rabbit Polyclonal Anti-ANGPTL5 Antibody

Product Images

WB Suggested Anti-ANGPTL5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ANGPTL5 Antibody: synthetic peptide directed towards the N terminal of human ANGPTL5. Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: angiopoietin like 5
• Database Link:
  NP_835228
  Entrez Gene 253935 Human
  UniProt ID Q86XS5
• Background: The exact functions of ANGPTL5 remain unknown.
• Synonyms: angiopoietin-like 5; fibrinogen-like
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein