Rabbit Polyclonal Anti-ANGPTL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ANGPTL5 Antibody: synthetic peptide directed towards the N terminal of human ANGPTL5. Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT |
ANGPTL5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ANGPTL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-388 of human ANGPTL5 (NP_835228.2). |
| Modifications | Unmodified |
ANGPTL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-388 of human ANGPTL5 (NP_835228.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
