Rabbit polyclonal anti-GPR75 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR75. |
Rabbit polyclonal anti-GPR75 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR75. |
Rabbit Polyclonal Anti-GPR75 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS |
Rabbit Polyclonal Anti-GPR75 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY |
Rabbit Polyclonal Anti-GPR75 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPR75 antibody: synthetic peptide directed towards the C terminal of human GPR75. Synthetic peptide located within the following region: ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA |
Rabbit Polyclonal Anti-GPR75 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR75 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GPR75. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%). |
Rabbit Polyclonal Anti-GPR75 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GPR75 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR75. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Panda, Bovine, Rabbit, Pig (94%); Mouse, Hamster, Elephant, Horse (89%); Rat, Bat, Lizard (83%). |
Rabbit Polyclonal Anti-GPR75 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | GPR75 antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human GPR75. Percent identity with other species by BLAST analysis: Human, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Gorilla, Monkey, Bat, Rabbit, Lizard, Xenopus, Pufferfish, Zebrafish (94%); Hamster (88%); Mouse, Rat, Chicken (81%). |