GPR75 Rabbit Polyclonal Antibody

CAT#: TA334745

Rabbit Polyclonal Anti-GPR75 Antibody

Product Images

WB Suggested Anti-GPR75 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:100; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR75 antibody: synthetic peptide directed towards the C terminal of human GPR75. Synthetic peptide located within the following region: ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: G protein-coupled receptor 75
• Database Link:
  NP_006785
  Entrez Gene 10936 Human
  UniProt ID O95800
• Background: GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.
• Synonyms: GPRchr2; WI31133
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane