Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPR75 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: PSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPS |
Rabbit Polyclonal Anti-GPR75 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPR75 Antibody: synthetic peptide directed towards the middle region of human GPR75. Synthetic peptide located within the following region: GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY |
Rabbit Polyclonal Anti-GPR75 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR75 antibody: synthetic peptide directed towards the C terminal of human GPR75. Synthetic peptide located within the following region: ALYRNQNYNKLQHVQTRGYTKSPNQLVTPAASRLQLVSAINLSTAKDSKA |
Rabbit Polyclonal Anti-GPR75 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR75 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GPR75. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%). |
Rabbit Polyclonal Anti-GPR75 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR75 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR75. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey, Panda, Bovine, Rabbit, Pig (94%); Mouse, Hamster, Elephant, Horse (89%); Rat, Bat, Lizard (83%). |
Rabbit Polyclonal Anti-GPR75 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GPR75 antibody was raised against synthetic 16 amino acid peptide from 2nd cytoplasmic domain of human GPR75. Percent identity with other species by BLAST analysis: Human, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Gorilla, Monkey, Bat, Rabbit, Lizard, Xenopus, Pufferfish, Zebrafish (94%); Hamster (88%); Mouse, Rat, Chicken (81%). |
GPR75 Rabbit polyclonal Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human GPR75. AA range:381-430 |
Active filters
Target Symbol
- GPR75