Goat Polyclonal Antibody against GPR40
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1. |
Goat Polyclonal Antibody against GPR40
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CAARTQGGKSQK, from the C Terminus of the protein sequence according to NP_005294.1. |
Rabbit Polyclonal Anti-FFAR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FFAR1 antibody: synthetic peptide directed towards the N terminal of human FFAR1. Synthetic peptide located within the following region: KVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLV |