Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-mGluR7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-mGluR7 Antibody: A synthesized peptide derived from human mGluR7 |
Goat Anti-GRM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NCKLTISGSKKEDT, from the internal region of the protein sequence according to NP_000835.1; NP_870989.1. |
GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%). |
Rabbit Polyclonal Anti-GRM7 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Dolphin, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Opossum, Turkey, Chicken (93%). |
Rabbit Polyclonal Anti-GRM7 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Bovine, Dog, Horse (100%); Rabbit (95%); Opossum, Turkey, Chicken (80%). |
Rabbit Polyclonal Anti-GRM7 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | GRM7 / MGLUR7 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Horse, Rabbit, Opossum, Turkey, Chicken (100%). |
Rabbit Polyclonal Anti-GRM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS |
Active filters
Target Symbol
- GRM7
Families
- GPCR