Antibodies

Jump to Filters
View as table Download
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA314039

USD 345.00

In Stock

Rabbit polyclonal anti-5-HT-1F antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-1F.
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA340657

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-HTR1F Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Bovine, Rabbit (100%); Mouse, Elephant, Panda, Bat, Guinea pig (95%); Platypus (84%).
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
AP20470PU-N

USD 370.00

2 Weeks

5 HT1F (HTR1F) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
RA30002-50

USD 525.00

2 Weeks

5 HT1F (HTR1F) rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA330006

USD 310.00

5 Days

Rabbit Polyclonal Anti-HTR1F Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR1F antibody: synthetic peptide directed towards the N terminal of human HTR1F. Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA340658

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR1F Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Rabbit, Guinea pig, Turkey, Chicken, Platypus (100%); Xenopus, Stickleback, Pufferfish (94%); Opossum, Lizard (88%); Horse (82%).
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA340659

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey, Panda, Bat (100%); Gibbon, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Rabbit (95%); Horse (89%).
5 HT1F (HTR1F) Rabbit Polyclonal Antibody
TA341022

USD 425.00

5 Days

Rabbit Polyclonal Anti-HTR1F Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR1F / 5-HT1F Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon (100%); Gorilla, Monkey, Bovine, Elephant, Horse, Rabbit, Guinea pig, Platypus (94%); Dog, Bat (88%); Rat, Panda (81%).