Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein. |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
CD38 mouse monoclonal antibody, clone T16, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
DNMT3B Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DNMT3B |
Rabbit polyclonal Anti-DNMT3B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
CD38 mouse monoclonal antibody, clone T16, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD38 mouse monoclonal antibody, clone T16, APC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | APC |
CD38 mouse monoclonal antibody, clone T16, PerCP-Cy5.5
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PerCP-Cy5.5 |
Mouse Anti-Human CD38 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat Anti-CD38 (aa226-237) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EVHNLQPEKVQT, from the internal region of the protein sequence according to NP_001766.2. |
Rabbit Polyclonal Anti-CD38 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CD38 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human CD38. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-CD38 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD38 antibody was raised against synthetic 16 amino acid peptide from internal region of human CD38. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla (94%); Marmoset (88%). |
Rabbit anti CD38 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
CD38 mouse monoclonal antibody,clone OTI1C9
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD38 mouse monoclonal antibody, clone OTI1H9
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD38 mouse monoclonal antibody, clone OTI8D5
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
2 Weeks
CD38 mouse monoclonal antibody, clone OTI11C3
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-DNMT3B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DNMT3B |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CD38 mouse monoclonal antibody,clone UMAB263
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
