CHRNA5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRNA5 |
CHRNA5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHRNA5 |
Rabbit Polyclonal Anti-CHRNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD |
Rabbit Polyclonal Anti-CHRNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS |