CHRNA5 Rabbit Polyclonal Antibody

CAT#: TA338362

Rabbit Polyclonal Anti-CHRNA5 Antibody

Product Images

WB Suggested Anti-CHRNA5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: cholinergic receptor nicotinic alpha 5 subunit
• Database Link:
  NP_000736
  Entrez Gene 1138 Human
  UniProt ID P30532
• Background: The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2). [provided by RefSeq, Jun 2010]
• Synonyms: LNCR2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Pig: 85%; Horse: 85%; Bovine: 85%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane