Antibodies

Jump to Filters
View as table Download
CHRND Rabbit Polyclonal Antibody
TA330429

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
CHRND (Center) Rabbit Polyclonal Antibody
AP50909PU-N

USD 450.00

2 Weeks

CHRND (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 175-204 amino acids from the Central region of human CHRND
CHRND Rabbit Polyclonal Antibody
TA330430

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA
CHRND Rabbit Polyclonal Antibody
TA338498

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHRND Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRND antibody: synthetic peptide directed towards the N terminal of human CHRND. Synthetic peptide located within the following region: RLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTN