Antibodies

View as table Download

Anti-KCNC3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 616-726 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 3

Goat Polyclonal Antibody against KCNC3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPGPPSFLPDLNAN, from the C Terminus of the protein sequence according to NP_004968.2.

Rabbit Polyclonal Anti-KCNC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3. Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM