KCNC3 Rabbit Polyclonal Antibody

CAT#: TA338545

Rabbit Polyclonal Anti-KCNC3 Antibody

Product Images

Host: Rabbit; Target Name: KCNC3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-KCNC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 293T cell lysate KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T

• 

  Host: Rabbit; Target Name: KCNC3; Sample Tissue: 293T; Antibody Dilution: 1.0 ug/ml KCNC3 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3. Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: potassium voltage-gated channel subfamily C member 3
• Database Link:
  NP_004968
  Entrez Gene 3748 Human
  UniProt ID Q14003
• Background: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. Alternate splicing results in several transcript variants. [provided by RefSeq, Mar 2014]
• Synonyms: KSHIIID; KV3.3; SCA13
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane