Antibodies

View as table Download

Rabbit Polyclonal Anti-TRPV6

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)NRGLEDGESWEYQI, corresponding to amino acid residues 712-725 of human TRPV6.Intracellular, C-terminus.

Rabbit Polyclonal TRPV6 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Rabbit Polyclonal Anti-Trpv6 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC