TRPV6 Rabbit Polyclonal Antibody

CAT#: TA338585

Rabbit Polyclonal Anti-Trpv6 Antibody

Product Images

Trpv6 antibody - middle region validated by WB using Rat Brain lysate at 1 ug/ml.

• 

  Sample Type: hRetinal pigment epithelial cells, 4 individual donors (20ug); Primary Dilution: 1:1000; Secondary Antibody: goat anti-rabbit-AP; Secondary Dilution: 1:2000; Image Submitted by: Brian Kennedy; Indiana University Northwest See Customer Feedbac

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 83 kDa
• Gene Name: transient receptor potential cation channel subfamily V member 6
• Database Link:
  NP_061116
  Entrez Gene 114246 RatEntrez Gene 55503 Human
  UniProt ID Q9H1D0
• Background: a Ca(2+)-sensing Ca(2+) channel [RGD, Feb 2006]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF160798.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369728, SRS369746 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: ABP; CAT1; CATL; ECAC2; HSA277909; LP6728; ZF; ZFAB
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane