Anti-HNF4A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha |
Anti-HNF4A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha |
Rabbit polyclonal HNF4A Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A. |
Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma |
Rabbit Polyclonal HNF4 alpha (Ser313) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HNF4 alpha around the phosphorylation site of Serine 313 |
Modifications | Phospho-specific |
Rabbit Polyclonal HNF4 alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human HNF4 alpha |
Rabbit Polyclonal Anti-HNF4A Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HNF4A antibody is: synthetic peptide directed towards the N-terminal region of Human HNF4A. Synthetic peptide located within the following region: MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNA |
Phospho-HNF4A-S304 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S304 of human HNF4A |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HNF4A Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: LPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYI |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF4A mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF4A mouse monoclonal antibody, clone OTI9H8 (formerly 9H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF4A mouse monoclonal antibody, clone OTI5A9 (formerly 5A9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HNF4A mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |