Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 9 of 9 results

(reset)

PTPN22 Rabbit Polyclonal Antibody

TA315315

USD 345.00

In Stock

Rabbit polyclonal anti-PTPN22 antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from Internal of human PTPN22.

PTPN22 Rabbit Polyclonal Antibody

TA347579

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22

PTPN22 Rabbit Polyclonal Antibody

TA334457

USD 375.00

5 Days

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL

PTPN22 Mouse Monoclonal Antibody [Clone ID: OTI6B1]

CF810177

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTPN22 mouse monoclonal antibody,clone OTI6B1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PTPN22 Rabbit Polyclonal Antibody

TA350310

USD 345.00

In Stock

Rabbit Polyclonal Anti-PTPN22 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human PTPN22

1 / 3

2 / 3

3 / 3

Previous Next

PTPN22 Mouse Monoclonal Antibody [Clone ID: OTI6B1]

TA810177

USD 379.00

In Stock

PTPN22 mouse monoclonal antibody,clone OTI6B1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PTPN22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B1]

TA810177AM

USD 420.00

2 Weeks

PTPN22 mouse monoclonal antibody,clone OTI6B1, Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PTPN22 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6B1]

TA810177BM

USD 420.00

2 Weeks

PTPN22 mouse monoclonal antibody,clone OTI6B1, HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

PTPN22 Mouse Monoclonal Antibody [Clone ID: OTI6B1]

TA810177S

USD 159.00

2 Days

PTPN22 mouse monoclonal antibody,clone OTI6B1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 9 of 9 results