Goat Polyclonal Antibody against PPP2CA / PPP2CB
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Goat Polyclonal Antibody against PPP2CA / PPP2CB
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1. |
Rabbit Polyclonal Anti-PPP2CA Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI |
Rabbit Polyclonal Anti-PPP2CA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP2CA |
PPP2CA Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |