Rabbit polyclonal anti-CPB2 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100% |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit polyclonal anti-CPB2 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100% |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit Polyclonal Anti-CPB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI |