Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody

CAT#: TA332132

Rabbit Polyclonal Anti-CPB2 Antibody

Product Images

WB Suggested Anti-CPB2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: carboxypeptidase B2
• Database Link:
  NP_001863
  Entrez Gene 1361 Human
  UniProt ID Q96IY4
• Background: Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). CPB2 is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis. Carboxypeptidases are enzymes that hydrolyze C-terminal peptide bonds. The carboxypeptidase family includes metallo-, serine, and cysteine carboxypeptidases. According to their substrate specificity, these enzymes are referred to as carboxypeptidase A (cleaving aliphatic residues) or carboxypeptidase B (cleaving basic amino residues). The protein encoded by this gene is activated by trypsin and acts on carboxypeptidase B substrates. After thrombin activation, the mature protein downregulates fibrinolysis. Polymorphisms have been described for this gene and its promoter region. Available sequence data analyses indicate splice variants that encode different isoforms.
• Synonyms: CPU; PCPB; TAFI
• Note: Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 92%; Dog: 86%; Horse: 85%; Pig: 83%; Rabbit: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Complement and coagulation cascades