Antibodies

Jump to Filters
View as table Download
Thimet Oligopeptidase (THOP1) Rabbit Polyclonal Antibody
TA334392

USD 375.00

5 Days

Rabbit Polyclonal Anti-THOP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human THOP1. Synthetic peptide located within the following region: MDYRSCILRPGGSEDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQV
Thimet Oligopeptidase (THOP1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D3]
TA501409AM

USD 420.00

4 Weeks

THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Thimet Oligopeptidase (THOP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA501409BM

USD 420.00

4 Weeks

THOP1 (Thimet Oligopeptidase) mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP