TMPRSS5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human TMPRSS5 |
TMPRSS5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human TMPRSS5 |
Goat Polyclonal Antibody against TMPRSS5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LDWIHDTAQDSLL, from the C Terminus of the protein sequence according to NP_110397.1. |
Rabbit Polyclonal Anti-TMPRSS5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMPRSS5 antibody: synthetic peptide directed towards the middle region of human TMPRSS5. Synthetic peptide located within the following region: SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN |
Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TMPRSS5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TMPRSS5 |
TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
TMPRSS5 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
TMPRSS5 mouse monoclonal antibody, clone OTI6E11 (formerly 6E11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
TMPRSS5 mouse monoclonal antibody, clone OTI6G10 (formerly 6G10)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
TMPRSS5 mouse monoclonal antibody, clone OTI7C3 (formerly 7C3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
TMPRSS5 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".