Rabbit anti-CDK9 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDK9 |
Rabbit anti-CDK9 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDK9 |
Rabbit polyclonal anti-Cdk9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Multiple synthetic peptides corresponding to C-terminal and N-terminal domains of the protein coded by the human gene cdk9 (PITALRE). |
Rabbit polyclonal CDK9 phospho T29 antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding T29 in the human CDK9 protein. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9. Synthetic peptide located within the following region: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKV |
Rabbit Polyclonal Anti-CDK9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK9 antibody: synthetic peptide directed towards the N terminal of human CDK9. Synthetic peptide located within the following region: PFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP |
Rabbit anti Cdk9 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human CDK9 protein. This sequence is identical to human, rat and mouse. |
Anti-CDK9 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-315 amino acids of human cyclin-dependent kinase 9 |