Rabbit polyclonal BLK (Tyr501) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLK around the phosphorylation site of tyrosine 501 (R-Q-YP-E-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BLK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLK antibody: synthetic peptide directed towards the middle region of human BLK. Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY |
Rabbit anti Blk Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to N-term of human Blk protein. This sequence is identical to mouse and rat. |
Germany
Japan
United Kingdom
China
