Antibodies

Jump to Filters
View as table Download
TRIB1 Rabbit Polyclonal Antibody
TA340200

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA
TRIB1 Rabbit Polyclonal Antibody
TA340201

USD 375.00

5 Days

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the C terminal of human TRIB1. Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF
TRIB1 Rabbit Polyclonal Antibody
TA351856

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRIB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRIB1