Rabbit polyclonal anti-CLK2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLK2. |
Rabbit polyclonal anti-CLK2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLK2. |
CLK2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 290-319 amino acids from the Central region of human CLK2 |
Rabbit Polyclonal Anti-CLK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CLK2 antibody is: synthetic peptide directed towards the N-terminal region of Human CLK2. Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF |